PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G011200.1
Common NamePHAVU_006G011200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family EIL
Protein Properties Length: 620aa    MW: 70433.6 Da    PI: 5.4531
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G011200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3518.23.6e-158494251353
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         +el++rmwkd+m+lkrlke++k+    ke  ++a k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+L
  Phvul.006G011200.1  49 DELERRMWKDKMRLKRLKEQSKS----KEG-IDAVKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNL 134
                         79*******************98....788.************************************************************ PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         r+WWk+kv+fdrngpaai+kyqa+n+i+++++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekg++pPWWP+G+e+ww+
  Phvul.006G011200.1 135 REWWKDKVRFDRNGPAAIAKYQADNAIPGRNDGCNS-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGIPPPWWPSGNEEWWP 224
                         **********************************88.9***************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXX CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrkq 270
                         + gl+kd+++ppykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++  ++  +  +
  Phvul.006G011200.1 225 QIGLPKDHSPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPDyiPPlASVGG 315
                         *********************************************************************************953344455* PP

                         XXXXXXXXXXXXXXX.XXXXXX.XXXXXXXXXX..............................XXXXXXXXXXXXXXXXXXXXX......X CS
                EIN3 271 spkvtlsceqkedve.gkkeskikhvqavktta..............................gfpvvrkrkkkpsesakvsskevsrtcq 330
                         s ++++++++++dve  ++e++  +v+ +k ++                              ++++ rkrk  + + + +  k  ++tc+
  Phvul.006G011200.1 316 SGSLVVNDSNEYDVEgCEDEPN-FDVEDRKHENvhttnlgmermrgtlagqqppfsikgeavtNLDFMRKRK-VSNDFNVMDMK--IYTCE 402
                         ***************5455555.667776666678888*************************9******99.55666666666..6**** PP

                         XXXXXX.XXXXXXXXXXXXXXXX CS
                EIN3 331 ssqfrgsetelifadknsisqne 353
                         + q+++s+++l+f+d+ s+++++
  Phvul.006G011200.1 403 QPQCPYSQVRLGFPDRISRDNHQ 425
                         *********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.0E-13049296No hitNo description
Gene3DG3DSA:1.10.3180.109.4E-76169305IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.14E-61175299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MMMMFEEMGF CNDLDTMSTV LGEEDITARQ TDPEAIVEDD FSDEEIGVDE LERRMWKDKM  60
RLKRLKEQSK SKEGIDAVKQ RQSQEQARRK KMSRAQDGIL KYMLKMMEVC KAQGFVYGII  120
PEKGKPVTGA SDNLREWWKD KVRFDRNGPA AIAKYQADNA IPGRNDGCNS IGPTPHTLQE  180
LQDTTLGSLL SALMQHCDPP QRRFPLEKGI PPPWWPSGNE EWWPQIGLPK DHSPPPYKKP  240
HDLKKAWKVG VLTAVIKHMS PDIAKIRKLV RQSKCLQDKM TAKESATWLA IINQEEALAR  300
ELYPDYIPPL ASVGGSGSLV VNDSNEYDVE GCEDEPNFDV EDRKHENVHT TNLGMERMRG  360
TLAGQQPPFS IKGEAVTNLD FMRKRKVSND FNVMDMKIYT CEQPQCPYSQ VRLGFPDRIS  420
RDNHQLICAY RGPSDFGGPN FHVNEVKPII YPQSFVQPKS TAQSANMVPP VIDLTGLEVS  480
EDGQKMISDL MTNYETNVQG NKNISSCNRI MAAENSCLRQ HGMQQPHDNF IRGQGITMEG  540
NIFDEPNMSN NHHIFAREEG QIERFKAMNA PFETNHNNNN NFNSMFGSFC DLASFDFKED  600
MQGAEMDGIQ KQPDFSIWY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A5e-841743052133Protein ETHYLENE INSENSITIVE 3
4zds_B5e-841743052133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146083.10.0hypothetical protein PHAVU_006G011200g
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLV7BJC60.0V7BJC6_PHAVU; Uncharacterized protein
STRINGGLYMA13G03660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein